SCOPe 2.05: Domain d4bh0e_: 4bh0 E:

Lineage for d4bh0e_ (4bh0 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza virus [TaxId:375457] [193026] (2 PDB entries)

8. Domain d4bh0e_: 4bh0 E: [219489]
   Other proteins in same PDB: d4bh0b_, d4bh0d_, d4bh0f_
   automated match to d4bgzc_
   complexed with nag, po4

Details for d4bh0e_

PDB Entry: 4bh0, 2.36 Å

PDB Description: h5 (tyty) influenza virus haemagglutinin in complex with human receptor analogue 6'-sln

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4bh0e_:

Sequence; same for both SEQRES and ATOM records:

>d4bh0e_ b.19.1.2 (E:) automated matches {Influenza virus [TaxId: 375457]}
pdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipk
sswsdheasagvssacpyqgrssffrnvvwlikkdnayptikrsynntnqedllvlwgih
hpndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
nfesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihplti
gecpkyvkssrlvlatglrn

Timeline for d4bh0e_:

• d4bh0e_ first appeared in SCOPe 2.03
  
• d4bh0e_ appears in SCOPe 2.04
  
• d4bh0e_ is called d4bh0e1 in SCOPe 2.06
  
• d4bh0e_ appears in the current release, SCOPe 2.08, called d4bh0e1