Lineage for d4bh0d_ (4bh0 D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041773Species Influenza virus [TaxId:375457] [256203] (2 PDB entries)
  8. 3041775Domain d4bh0d_: 4bh0 D: [240021]
    Other proteins in same PDB: d4bh0a_, d4bh0c_, d4bh0e1, d4bh0e2
    automated match to d2fk0b1
    complexed with nag, po4

Details for d4bh0d_

PDB Entry: 4bh0 (more details), 2.36 Å

PDB Description: h5 (tyty) influenza virus haemagglutinin in complex with human receptor analogue 6'-sln
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4bh0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh0d_ h.3.1.1 (D:) automated matches {Influenza virus [TaxId: 375457]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
akelgngcfefyhrcdnecmesvrngty

SCOPe Domain Coordinates for d4bh0d_:

Click to download the PDB-style file with coordinates for d4bh0d_.
(The format of our PDB-style files is described here.)

Timeline for d4bh0d_: