![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
![]() | Protein automated matches [190438] (36 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226179] (2 PDB entries) |
![]() | Domain d3stjf1: 3stj F:11-236 [239761] Other proteins in same PDB: d3stja2, d3stjb2, d3stjc2, d3stjd2, d3stje2, d3stjf2, d3stjg2, d3stjh2, d3stji2, d3stjj2, d3stjk2, d3stjl2 automated match to d3stjb1 |
PDB Entry: 3stj (more details), 2.6 Å
SCOPe Domain Sequences for d3stjf1:
Sequence, based on SEQRES records: (download)
>d3stjf1 b.47.1.0 (F:11-236) automated matches {Escherichia coli K-12 [TaxId: 83333]} plpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqpfeglgsgvii naskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqnpskltqiaia dsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtdasinrgnsgga llnlngeligintailapgggsvgigfaipsnmartlaqqlidfge
>d3stjf1 b.47.1.0 (F:11-236) automated matches {Escherichia coli K-12 [TaxId: 83333]} plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg igfaipsnmartlaqqlidfge
Timeline for d3stjf1: