Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [233623] (1 PDB entry) |
Domain d3stjc2: 3stj C:237-334 [233628] Other proteins in same PDB: d3stja1, d3stjb1, d3stjc1, d3stjd1, d3stje1, d3stjf1, d3stjg1, d3stjh1, d3stji1, d3stjj1, d3stjk1, d3stjl1 automated match to d1ky9a1 |
PDB Entry: 3stj (more details), 2.6 Å
SCOPe Domain Sequences for d3stjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3stjc2 b.36.1.0 (C:237-334) automated matches {Escherichia coli K-12 [TaxId: 83333]} ikrgllgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkpln sfaelrsriattepgtkvklgllrngkplevevtldts
Timeline for d3stjc2: