PDB entry 3stj

View 3stj on RCSB PDB site
Description: Crystal structure of the protease + PDZ1 domain of DegQ from Escherichia coli
Class: hydrolase
Keywords: serine protease, PDZ domain, protease, chaperone, DegP, DegQ, HYDROLASE
Deposited on 2011-07-11, released 2011-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.186
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stja1, d3stja2
  • Chain 'B':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjb1, d3stjb2
  • Chain 'C':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjc1, d3stjc2
  • Chain 'D':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjd1, d3stjd2
  • Chain 'E':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stje1, d3stje2
  • Chain 'F':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjf1, d3stjf2
  • Chain 'G':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjg1, d3stjg2
  • Chain 'H':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjh1, d3stjh2
  • Chain 'I':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stji1, d3stji2
  • Chain 'J':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjj1, d3stjj2
  • Chain 'K':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjk1, d3stjk2
  • Chain 'L':
    Compound: Protease degQ
    Species: Escherichia coli [TaxId:83333]
    Gene: degQ, hhoA, b3234, JW3203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stjl1, d3stjl2
  • Chain 'M':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'N':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'O':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'P':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'Q':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'R':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'S':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'T':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'U':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'V':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'W':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'X':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ
  • Chain 'Z':
    Compound: peptide (UNK)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3STJ (0-6)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3stjA (A:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjA (A:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3stjB (B:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjB (B:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3stjC (C:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjC (C:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3stjD (D:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjD (D:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3stjE (E:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjE (E:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3stjF (F:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjF (F:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3stjG (G:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjG (G:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3stjH (H:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjH (H:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3stjI (I:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjI (I:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3stjJ (J:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjJ (J:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3stjK (K:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjK (K:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3stjL (L:)
    sipgqvadqaplpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqp
    feglgsgviinaskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqn
    pskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtda
    sinrgnsggallnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeikrg
    llgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkplnsfae
    lrsriattepgtkvklgllrngkplevevtldtstsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stjL (L:)
    plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
    ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
    tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
    igfaipsnmartlaqqlidfgeikrgllgikgtemsadiakafnldvqrgafvsevlpgs
    gsakagvkagdiitslngkplnsfaelrsriattepgtkvklgllrngkplevevtldts
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Z':
    No sequence available.