SCOPe 2.03: Domain d3stjc2: 3stj C:237-334

Lineage for d3stjc2 (3stj C:237-334)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [233623] (1 PDB entry)

8. Domain d3stjc2: 3stj C:237-334 [233628]
   Other proteins in same PDB: d3stja1, d3stjb1, d3stjc1, d3stjd1
   automated match to d1ky9a1

Details for d3stjc2

PDB Entry: 3stj, 2.6 Å

PDB Description: Crystal structure of the protease + PDZ1 domain of DegQ from Escherichia coli

PDB Compounds: (C:) Protease degQ

SCOPe Domain Sequences for d3stjc2:

Sequence; same for both SEQRES and ATOM records:

>d3stjc2 b.36.1.0 (C:237-334) automated matches {Escherichia coli [TaxId: 83333]}
ikrgllgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkpln
sfaelrsriattepgtkvklgllrngkplevevtldts

Timeline for d3stjc2:

• d3stjc2 is new in SCOPe 2.03-stable
  
• d3stjc2 appears in SCOPe 2.04
  
• d3stjc2 appears in the current release, SCOPe 2.08