SCOPe 2.08: Domain d3eubt2: 3eub T:415-528

Lineage for d3eubt2 (3eub T:415-528)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)

8. Domain d3eubt2: 3eub T:415-528 [239261]
   Other proteins in same PDB: d3eub21, d3eub22, d3eub31, d3eub41, d3eub42, d3euba1, d3euba2, d3eubb1, d3eubc1, d3eubc2, d3eubj1, d3eubj2, d3eubk1, d3eubl1, d3eubl2, d3eubs1, d3eubs2, d3eubt1, d3eubu1, d3eubu2
   automated match to d3eub32
   complexed with fad, fes, mom, mte, xan

Details for d3eubt2

PDB Entry: 3eub, 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (T:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eubt2:

Sequence; same for both SEQRES and ATOM records:

>d3eubt2 d.87.2.0 (T:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3eubt2:

• d3eubt2 first appeared in SCOPe 2.04
  
• d3eubt2 appears in SCOPe 2.07