![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
![]() | Protein automated matches [232070] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries) |
![]() | Domain d3eubk1: 3eub K:226-414 [239254] Other proteins in same PDB: d3eub21, d3eub22, d3eub32, d3eub41, d3eub42, d3euba1, d3euba2, d3eubb2, d3eubc1, d3eubc2, d3eubj1, d3eubj2, d3eubk2, d3eubl1, d3eubl2, d3eubs1, d3eubs2, d3eubt2, d3eubu1, d3eubu2 automated match to d3eub31 complexed with fad, fes, mom, mte, xan |
PDB Entry: 3eub (more details), 2.6 Å
SCOPe Domain Sequences for d3eubk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eubk1 d.145.1.3 (K:226-414) automated matches {Cow (Bos taurus) [TaxId: 9913]} qlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawip elnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvksv aslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeill sieipysre
Timeline for d3eubk1: