Lineage for d3eubb1 (3eub B:224-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987556Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2987615Protein automated matches [232070] (2 species)
    not a true protein
  7. 2987616Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)
  8. 2987638Domain d3eubb1: 3eub B:224-414 [232082]
    Other proteins in same PDB: d3eub21, d3eub22, d3eub32, d3eub41, d3eub42, d3euba1, d3euba2, d3eubb2, d3eubc1, d3eubc2, d3eubj1, d3eubj2, d3eubk2, d3eubl1, d3eubl2, d3eubs1, d3eubs2, d3eubt2, d3eubu1, d3eubu2
    automated match to d3b9jb2
    complexed with fad, fes, mom, mte, xan

Details for d3eubb1

PDB Entry: 3eub (more details), 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eubb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eubb1 d.145.1.3 (B:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3eubb1:

Click to download the PDB-style file with coordinates for d3eubb1.
(The format of our PDB-style files is described here.)

Timeline for d3eubb1: