SCOPe 2.06: Domain d3a01e_: 3a01 E:

Lineage for d3a01e_ (3a01 E:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (6 PDB entries)

8. Domain d3a01e_: 3a01 E: [239081]
   automated match to d1b8ia_
   protein/DNA complex

Details for d3a01e_

PDB Entry: 3a01, 2.7 Å

PDB Description: Crystal structure of Aristaless and Clawless homeodomains bound to DNA

PDB Compounds: (E:) Homeodomain-containing protein

SCOPe Domain Sequences for d3a01e_:

Sequence, based on SEQRES records:

>d3a01e_ a.4.1.1 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hpyqnrtppkrkkprtsftriqvaelekrfhkqkylasaeraalarglkmtdaqvktwfq
nrrtkwrrqtaee

Sequence, based on observed residues (ATOM records):

>d3a01e_ a.4.1.1 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hpyqnrtpprtsftriqvaelekrfhkqkylasaeraalarglkmtdaqvktwfqnrrtk
wrrqtaee

Timeline for d3a01e_:

• d3a01e_ first appeared in SCOPe 2.04
  
• d3a01e_ appears in SCOPe 2.05
  
• d3a01e_ appears in SCOPe 2.07
  
• d3a01e_ appears in the current release, SCOPe 2.08