Lineage for d3a01e_ (3a01 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305224Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2305415Protein automated matches [190360] (3 species)
    not a true protein
  7. 2305416Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (6 PDB entries)
  8. 2305421Domain d3a01e_: 3a01 E: [239081]
    automated match to d1b8ia_
    protein/DNA complex

Details for d3a01e_

PDB Entry: 3a01 (more details), 2.7 Å

PDB Description: Crystal structure of Aristaless and Clawless homeodomains bound to DNA
PDB Compounds: (E:) Homeodomain-containing protein

SCOPe Domain Sequences for d3a01e_:

Sequence, based on SEQRES records: (download)

>d3a01e_ a.4.1.1 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hpyqnrtppkrkkprtsftriqvaelekrfhkqkylasaeraalarglkmtdaqvktwfq
nrrtkwrrqtaee

Sequence, based on observed residues (ATOM records): (download)

>d3a01e_ a.4.1.1 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hpyqnrtpprtsftriqvaelekrfhkqkylasaeraalarglkmtdaqvktwfqnrrtk
wrrqtaee

SCOPe Domain Coordinates for d3a01e_:

Click to download the PDB-style file with coordinates for d3a01e_.
(The format of our PDB-style files is described here.)

Timeline for d3a01e_: