Lineage for d2y69m_ (2y69 M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025475Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 3025476Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 3025537Protein automated matches [190273] (1 species)
    not a true protein
  7. 3025538Species Cow (Bos taurus) [TaxId:9913] [187065] (26 PDB entries)
  8. 3025579Domain d2y69m_: 2y69 M: [239028]
    Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_
    automated match to d1v54m_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69m_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (M:) cytochrome c oxidase polypeptide 8h

SCOPe Domain Sequences for d2y69m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69m_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d2y69m_:

Click to download the PDB-style file with coordinates for d2y69m_.
(The format of our PDB-style files is described here.)

Timeline for d2y69m_: