Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries) |
Domain d2rdxh2: 2rdx H:128-368 [238857] Other proteins in same PDB: d2rdxa1, d2rdxa3, d2rdxb1, d2rdxb3, d2rdxc1, d2rdxc3, d2rdxd1, d2rdxd3, d2rdxe1, d2rdxe3, d2rdxe4, d2rdxf1, d2rdxf2, d2rdxg1, d2rdxg3, d2rdxh1, d2rdxh3 automated match to d2rdxb2 complexed with gol, mg |
PDB Entry: 2rdx (more details), 2 Å
SCOPe Domain Sequences for d2rdxh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdxh2 c.1.11.0 (H:128-368) automated matches {Roseovarius nubinhibens [TaxId: 89187]} klcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidriraclpllepg ekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmkldecvtgl hmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggeiasaavahf aastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnslgapvadwa l
Timeline for d2rdxh2: