PDB entry 2rdx

View 2rdx on RCSB PDB site
Description: Crystal structure of mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM
Class: structural genomics, unknown function
Keywords: ENOLASE, RACEMASE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NYSGRC, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2007-09-25, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2rdxa1, d2rdxa2, d2rdxa3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2rdxb1, d2rdxb2, d2rdxb3
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2rdxc1, d2rdxc2, d2rdxc3
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2rdxd1, d2rdxd2, d2rdxd3
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-370)
      • expression tag (1-2)
      • expression tag (371-372)
    Domains in SCOPe 2.07: d2rdxe1, d2rdxe2, d2rdxe3, d2rdxe4
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2rdxf1, d2rdxf2
  • Chain 'G':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-370)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2rdxg1, d2rdxg2, d2rdxg3
  • Chain 'H':
    Compound: Mandelate racemase/muconate lactonizing enzyme, putative
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: ISM_14070
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2rdxh1, d2rdxh2, d2rdxh3
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rdxA (A:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxA (A:)
    slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
    ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
    pvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrira
    clpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmk
    ldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggei
    asaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnsl
    gapvadwal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rdxB (B:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxB (B:)
    slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
    ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
    pvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrira
    clpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmk
    ldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggei
    asaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnsl
    gapvadwal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rdxC (C:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxC (C:)
    slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
    ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
    pvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrira
    clpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmk
    ldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggei
    asaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnsl
    gapvadwal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rdxD (D:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxD (D:)
    slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
    ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
    pvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrira
    clpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmk
    ldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggei
    asaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnsl
    gapvadwal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2rdxE (E:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxE (E:)
    slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
    ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
    pvwmllggklcdgapmyrvapqaetraelarhraagyrqfqikvgadwqsdidriraclp
    llepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmklde
    cvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggeiasa
    avahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnslgap
    vadwalpeg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2rdxF (F:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxF (F:)
    slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
    ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
    pvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrira
    clpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmk
    ldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggei
    asaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnsl
    gapvadwal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2rdxG (G:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxG (G:)
    slritrirlyktdlpyvdgtvarasvvvidtdaglqgcgeftpcgenymiahsegvdafa
    rlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgqpvwmllggkl
    cdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidriraclpllepgek
    amadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmkldecvtglhm
    aqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggeiasaavahfaa
    stpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnslgapvadwalp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2rdxH (H:)
    mslritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenym
    iahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatg
    qpvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrir
    aclpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpm
    kldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswgge
    iasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfns
    lgapvadwalpeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdxH (H:)
    slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
    ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
    pvwmllggklcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidrira
    clpllepgekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmk
    ldecvtglhmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggei
    asaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnsl
    gapvadwal