Lineage for d2rdxg1 (2rdx G:2-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948495Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)
  8. 2948518Domain d2rdxg1: 2rdx G:2-127 [238854]
    Other proteins in same PDB: d2rdxa2, d2rdxa3, d2rdxb2, d2rdxb3, d2rdxc2, d2rdxc3, d2rdxd2, d2rdxd3, d2rdxe2, d2rdxe3, d2rdxe4, d2rdxf2, d2rdxg2, d2rdxg3, d2rdxh2, d2rdxh3
    automated match to d2rdxe1
    complexed with gol, mg

Details for d2rdxg1

PDB Entry: 2rdx (more details), 2 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
PDB Compounds: (G:) Mandelate racemase/muconate lactonizing enzyme, putative

SCOPe Domain Sequences for d2rdxg1:

Sequence, based on SEQRES records: (download)

>d2rdxg1 d.54.1.0 (G:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
ritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymiah
segvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgqpv
wmllgg

Sequence, based on observed residues (ATOM records): (download)

>d2rdxg1 d.54.1.0 (G:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
ritrirlyktdlpyvdgtvarasvvvidtdaglqgcgeftpcgenymiahsegvdafarl
aapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgqpvwmllgg

SCOPe Domain Coordinates for d2rdxg1:

Click to download the PDB-style file with coordinates for d2rdxg1.
(The format of our PDB-style files is described here.)

Timeline for d2rdxg1: