| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (45 species) not a true protein |
| Species Aquifex aeolicus [TaxId:224324] [230695] (1 PDB entry) |
| Domain d2ebda2: 2ebd A:173-309 [238639] |
PDB Entry: 2ebd (more details), 2.1 Å
SCOPe Domain Sequences for d2ebda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebda2 c.95.1.0 (A:173-309) automated matches {Aquifex aeolicus [TaxId: 224324]}
dilatrmyaegsleellhadncgyirmkgrelfkvavrsmeevcrevlekagvkpeevsl
viphqanvriinalaeklnipkekvfvniqkygntsaasipialheaikegkvkrgdlil
mtamgggltwgavllry
Timeline for d2ebda2: