SCOPe 2.04: Domain d2ebda1: 2ebd A:1-172

Lineage for d2ebda1 (2ebd A:1-172)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [230695] (1 PDB entry)

8. Domain d2ebda1: 2ebd A:1-172 [238638]

Details for d2ebda1

PDB Entry: 2ebd, 2.1 Å

PDB Description: crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2ebda1:

Sequence; same for both SEQRES and ATOM records:

>d2ebda1 c.95.1.0 (A:1-172) automated matches {Aquifex aeolicus [TaxId: 224324]}
mgtkiigtgvylpknvltnfdlekivdtsdewittrtgikerriakeetitymatqaake
alreanlspeeldliilatltpqkrfpstaclvqaqlkakgvyafdisaacsgfiyaldi
adsfiksgkaknvlvigaeklseavdwedrstcvlfgdgagavvvtrsedks

Timeline for d2ebda1:

• d2ebda1 is new in SCOPe 2.04-stable
  
• d2ebda1 appears in SCOPe 2.05
  
• d2ebda1 appears in the current release, SCOPe 2.08