Lineage for d2ebda2 (2ebd A:173-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917385Species Aquifex aeolicus [TaxId:224324] [230695] (1 PDB entry)
  8. 2917387Domain d2ebda2: 2ebd A:173-309 [238639]

Details for d2ebda2

PDB Entry: 2ebd (more details), 2.1 Å

PDB Description: crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2ebda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebda2 c.95.1.0 (A:173-309) automated matches {Aquifex aeolicus [TaxId: 224324]}
dilatrmyaegsleellhadncgyirmkgrelfkvavrsmeevcrevlekagvkpeevsl
viphqanvriinalaeklnipkekvfvniqkygntsaasipialheaikegkvkrgdlil
mtamgggltwgavllry

SCOPe Domain Coordinates for d2ebda2:

Click to download the PDB-style file with coordinates for d2ebda2.
(The format of our PDB-style files is described here.)

Timeline for d2ebda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebda1