SCOPe 2.08: Domain d1tx6i2: 1tx6 I:5-64

Lineage for d1tx6i2 (1tx6 I:5-64)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein automated matches [192457] (4 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [254905] (2 PDB entries)

8. Domain d1tx6i2: 1tx6 I:5-64 [238558]
   Other proteins in same PDB: d1tx6a_, d1tx6b_, d1tx6c_, d1tx6d_
   automated match to d1c2aa1
   complexed with ca

Details for d1tx6i2

PDB Entry: 1tx6, 2.2 Å

PDB Description: trypsin:BBI complex

PDB Compounds: (I:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d1tx6i2:

Sequence, based on SEQRES records:

>d1tx6i2 g.3.13.1 (I:5-64) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
rpwkccdeavctrsippictcmdevfecpktckscgpsmgdpsrricqdqyvgdpgpicr

Sequence, based on observed residues (ATOM records):

>d1tx6i2 g.3.13.1 (I:5-64) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
rpwkccdeavctrsippictcmdevfecckscgpsmgdpsrricqdqyvgdpgpicr

Timeline for d1tx6i2:

• d1tx6i2 first appeared in SCOPe 2.04
  
• d1tx6i2 appears in SCOPe 2.07