Lineage for d1tx6i1 (1tx6 I:65-125)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2583364Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2583365Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2583391Protein automated matches [192457] (4 species)
    not a true protein
  7. 2583392Species Barley (Hordeum vulgare) [TaxId:4513] [254905] (2 PDB entries)
  8. 2583395Domain d1tx6i1: 1tx6 I:65-125 [119379]
    Other proteins in same PDB: d1tx6a_, d1tx6b_, d1tx6c_, d1tx6d_
    automated match to d1c2aa2
    complexed with ca

Details for d1tx6i1

PDB Entry: 1tx6 (more details), 2.2 Å

PDB Description: trypsin:BBI complex
PDB Compounds: (I:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d1tx6i1:

Sequence, based on SEQRES records: (download)

>d1tx6i1 g.3.13.1 (I:65-125) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
pweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprctp
r

Sequence, based on observed residues (ATOM records): (download)

>d1tx6i1 g.3.13.1 (I:65-125) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
pweccdkaictrsnpptcrcvdevkkcaptcktclrvcidsyfgpvpprctpr

SCOPe Domain Coordinates for d1tx6i1:

Click to download the PDB-style file with coordinates for d1tx6i1.
(The format of our PDB-style files is described here.)

Timeline for d1tx6i1: