SCOPe 2.05: Domain d1qrja2: 1qrj A:16-130

Lineage for d1qrja2 (1qrj A:16-130)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HTLV-I capsid protein [47949] (1 species)

7. Species Human T-cell leukemia virus type 1 [TaxId:11908] [47950] (2 PDB entries)

8. Domain d1qrja2: 1qrj A:16-130 [238531]
   Other proteins in same PDB: d1qrja1

Details for d1qrja2

PDB Entry: 1qrj

PDB Description: Solution structure of htlv-i capsid protein

PDB Compounds: (A:) htlv-I capsid protein

SCOPe Domain Sequences for d1qrja2:

Sequence; same for both SEQRES and ATOM records:

>d1qrja2 a.73.1.1 (A:16-130) HTLV-I capsid protein {Human T-cell leukemia virus type 1 [TaxId: 11908]}
qmkdlqaikqevsqaapgspqfmqtirlavqqfdptakdlqdllqylcsslvaslhhqql
dsliseaetrgitgynplagplrvqannpqqqglrreyqqlwlaafaalpgsakd

Timeline for d1qrja2:

• d1qrja2 first appeared in SCOPe 2.04
  
• d1qrja2 appears in SCOPe 2.06
  
• d1qrja2 appears in the current release, SCOPe 2.08