Lineage for d1qrja2 (1qrj A:16-130)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2718001Protein HTLV-I capsid protein [47949] (1 species)
  7. 2718002Species Human T-cell leukemia virus type 1 [TaxId:11908] [47950] (2 PDB entries)
  8. 2718003Domain d1qrja2: 1qrj A:16-130 [238531]
    Other proteins in same PDB: d1qrja1, d1qrja3

Details for d1qrja2

PDB Entry: 1qrj (more details)

PDB Description: Solution structure of htlv-i capsid protein
PDB Compounds: (A:) htlv-I capsid protein

SCOPe Domain Sequences for d1qrja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrja2 a.73.1.1 (A:16-130) HTLV-I capsid protein {Human T-cell leukemia virus type 1 [TaxId: 11908]}
qmkdlqaikqevsqaapgspqfmqtirlavqqfdptakdlqdllqylcsslvaslhhqql
dsliseaetrgitgynplagplrvqannpqqqglrreyqqlwlaafaalpgsakd

SCOPe Domain Coordinates for d1qrja2:

Click to download the PDB-style file with coordinates for d1qrja2.
(The format of our PDB-style files is described here.)

Timeline for d1qrja2: