SCOPe 2.05: Domain d1qrja1: 1qrj A:131-214

Lineage for d1qrja1 (1qrj A:131-214)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein HTLV-I capsid protein [47357] (1 species)

7. Species Human T-cell leukemia virus type 1 [TaxId:11908] [47358] (1 PDB entry)

8. Domain d1qrja1: 1qrj A:131-214 [238530]
   Other proteins in same PDB: d1qrja2

Details for d1qrja1

PDB Entry: 1qrj

PDB Description: Solution structure of htlv-i capsid protein

PDB Compounds: (A:) htlv-I capsid protein

SCOPe Domain Sequences for d1qrja1:

Sequence; same for both SEQRES and ATOM records:

>d1qrja1 a.28.3.1 (A:131-214) HTLV-I capsid protein {Human T-cell leukemia virus type 1 [TaxId: 11908]}
pswasilqgleepyhafverlnialdnglpegtpkdpilrslaysnankecqkllqargh
tnsplgdmlracqtwtpkdktkvl

Timeline for d1qrja1:

• d1qrja1 first appeared in SCOPe 2.04
  
• d1qrja1 appears in SCOPe 2.06
  
• d1qrja1 appears in the current release, SCOPe 2.08