Lineage for d1qrja1 (1qrj A:131-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706513Protein HTLV-I capsid protein [47357] (1 species)
  7. 2706514Species Human T-cell leukemia virus type 1 [TaxId:11908] [47358] (1 PDB entry)
  8. 2706515Domain d1qrja1: 1qrj A:131-214 [238530]
    Other proteins in same PDB: d1qrja2, d1qrja3

Details for d1qrja1

PDB Entry: 1qrj (more details)

PDB Description: Solution structure of htlv-i capsid protein
PDB Compounds: (A:) htlv-I capsid protein

SCOPe Domain Sequences for d1qrja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrja1 a.28.3.1 (A:131-214) HTLV-I capsid protein {Human T-cell leukemia virus type 1 [TaxId: 11908]}
pswasilqgleepyhafverlnialdnglpegtpkdpilrslaysnankecqkllqargh
tnsplgdmlracqtwtpkdktkvl

SCOPe Domain Coordinates for d1qrja1:

Click to download the PDB-style file with coordinates for d1qrja1.
(The format of our PDB-style files is described here.)

Timeline for d1qrja1: