Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries) |
Domain d1nobc_: 1nob C: [23852] |
PDB Entry: 1nob (more details), 2.6 Å
SCOPe Domain Sequences for d1nobc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nobc_ b.21.1.1 (C:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 12 [TaxId: 28282]} tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs yitqe
Timeline for d1nobc_: