Lineage for d1nobd_ (1nob D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776932Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries)
  8. 2776937Domain d1nobd_: 1nob D: [23853]

Details for d1nobd_

PDB Entry: 1nob (more details), 2.6 Å

PDB Description: knob domain from adenovirus serotype 12
PDB Compounds: (D:) protein (fiber knob protein)

SCOPe Domain Sequences for d1nobd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nobd_ b.21.1.1 (D:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 12 [TaxId: 28282]}
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

SCOPe Domain Coordinates for d1nobd_:

Click to download the PDB-style file with coordinates for d1nobd_.
(The format of our PDB-style files is described here.)

Timeline for d1nobd_: