Lineage for d1nobb_ (1nob B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041113Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2041114Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2041115Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 protein domains)
    automatically mapped to Pfam PF00541
  6. 2041116Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2041182Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries)
  8. 2041186Domain d1nobb_: 1nob B: [23851]

Details for d1nobb_

PDB Entry: 1nob (more details), 2.6 Å

PDB Description: knob domain from adenovirus serotype 12
PDB Compounds: (B:) protein (fiber knob protein)

SCOPe Domain Sequences for d1nobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nobb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus type 12 [TaxId: 28282]}
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

SCOPe Domain Coordinates for d1nobb_:

Click to download the PDB-style file with coordinates for d1nobb_.
(The format of our PDB-style files is described here.)

Timeline for d1nobb_: