![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein automated matches [226970] (6 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [232226] (7 PDB entries) |
![]() | Domain d3sfia2: 3sfi A:95-214 [238508] Other proteins in same PDB: d3sfia1 automated match to d3g1ma2 protein/DNA complex; complexed with 3sf |
PDB Entry: 3sfi (more details), 2.31 Å
SCOPe Domain Sequences for d3sfia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfia2 a.121.1.1 (A:95-214) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d3sfia2: