Lineage for d4pp8c_ (4pp8 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642631Protein NK cell ligand RAE-1 beta [69683] (1 species)
  7. 1642632Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries)
  8. 1642633Domain d4pp8c_: 4pp8 C: [238501]
    Other proteins in same PDB: d4pp8a_, d4pp8b_
    automated match to d1jfma_
    complexed with gol

Details for d4pp8c_

PDB Entry: 4pp8 (more details), 1.95 Å

PDB Description: Crystal structure of murine NK cell ligand RAE-1 beta in complex with NKG2D
PDB Compounds: (C:) Retinoic acid early-inducible protein 1-beta

SCOPe Domain Sequences for d4pp8c_:

Sequence, based on SEQRES records: (download)

>d4pp8c_ d.19.1.1 (C:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
hslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkclt
qplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyfftf
ytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkq

Sequence, based on observed residues (ATOM records): (download)

>d4pp8c_ d.19.1.1 (C:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
hslrcnltikdptpadplwyeakcfvgeililhlsninatevkkcltqplknlcqklrnk
vsntyphlqvtmiypqsqgrtpsatwefnisdsyfftfytenmswrsandesgvimnkwk
ddgefvkqlkflihecsqkmdeflkq

SCOPe Domain Coordinates for d4pp8c_:

Click to download the PDB-style file with coordinates for d4pp8c_.
(The format of our PDB-style files is described here.)

Timeline for d4pp8c_: