Lineage for d4pp8b_ (4pp8 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682344Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 1682351Species Mouse (Mus musculus) [TaxId:10090] [64454] (2 PDB entries)
  8. 1682354Domain d4pp8b_: 4pp8 B: [238499]
    Other proteins in same PDB: d4pp8c_, d4pp8d_
    complexed with gol

Details for d4pp8b_

PDB Entry: 4pp8 (more details), 1.95 Å

PDB Description: Crystal structure of murine NK cell ligand RAE-1 beta in complex with NKG2D
PDB Compounds: (B:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d4pp8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pp8b_ d.169.1.1 (B:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]}
megycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvks
yhwmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyic
mkrav

SCOPe Domain Coordinates for d4pp8b_:

Click to download the PDB-style file with coordinates for d4pp8b_.
(The format of our PDB-style files is described here.)

Timeline for d4pp8b_: