SCOPe 2.03: Domain d4pp8b_: 4pp8 B:

Lineage for d4pp8b_ (4pp8 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187300] (4 PDB entries)

8. Domain d4pp8b_: 4pp8 B: [238499]
   Other proteins in same PDB: d4pp8c_, d4pp8d_
   automated match to d1hyra_
   complexed with gol

Details for d4pp8b_

PDB Entry: 4pp8, 1.95 Å

PDB Description: Crystal structure of murine NK cell ligand RAE-1 beta in complex with NKG2D

PDB Compounds: (B:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d4pp8b_:

Sequence; same for both SEQRES and ATOM records:

>d4pp8b_ d.169.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
megycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvks
yhwmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyic
mkrav

Timeline for d4pp8b_:

• d4pp8b_ is new in SCOPe 2.03-stable
  
• d4pp8b_ appears in SCOPe 2.04
  
• d4pp8b_ appears in the current release, SCOPe 2.08