Lineage for d1jfma_ (1jfm A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642631Protein NK cell ligand RAE-1 beta [69683] (1 species)
  7. 1642632Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries)
  8. 1642635Domain d1jfma_: 1jfm A: [66640]

Details for d1jfma_

PDB Entry: 1jfm (more details), 2.85 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta
PDB Compounds: (A:) retinoic acid early transcript beta

SCOPe Domain Sequences for d1jfma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfma_ d.19.1.1 (A:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek

SCOPe Domain Coordinates for d1jfma_:

Click to download the PDB-style file with coordinates for d1jfma_.
(The format of our PDB-style files is described here.)

Timeline for d1jfma_: