SCOPe 2.08: Domain d4hmge_: 4hmg E:

Lineage for d4hmge_ (4hmg E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d4hmge_: 4hmg E: [23833]
   Other proteins in same PDB: d4hmgb_, d4hmgd_, d4hmgf_
   complexed with nag, sia

Details for d4hmge_

PDB Entry: 4hmg, 3 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

PDB Compounds: (E:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d4hmge_:

Sequence; same for both SEQRES and ATOM records:

>d4hmge_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d4hmge_:

• d4hmge_ first appeared (with stable ids) in SCOP 1.55
  
• d4hmge_ appears in SCOPe 2.07