PDB entry 4hmg

View 4hmg on RCSB PDB site
Description: refinement of the influenza virus hemagglutinin by simulated annealing
Class: Viral Protein
Keywords: INFLUENZA VIRUS HEMAGGLUTININ, Viral Protein
Deposited on 1989-09-11, released 1991-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-327)
      • conflict (225)
    Domains in SCOPe 2.07: d4hmga_
  • Chain 'B':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hmgb_
  • Chain 'C':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-327)
      • conflict (225)
    Domains in SCOPe 2.07: d4hmgc_
  • Chain 'D':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hmgd_
  • Chain 'E':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-327)
      • conflict (225)
    Domains in SCOPe 2.07: d4hmge_
  • Chain 'F':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hmgf_
  • Heterogens: SIA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hmgA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hmgB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hmgC (C:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hmgD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hmgE (E:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hmgF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg