Lineage for d4hmge_ (4hmg E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12156Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)
  4. 12157Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families) (S)
  5. 12184Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 12185Protein Hemagglutinin [49824] (1 species)
  7. 12186Species Influenza A virus, different strains [TaxId:11320] [49825] (18 PDB entries)
  8. 12223Domain d4hmge_: 4hmg E: [23833]
    Other proteins in same PDB: d4hmgb_, d4hmgd_, d4hmgf_

Details for d4hmge_

PDB Entry: 4hmg (more details), 3 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

SCOP Domain Sequences for d4hmge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hmge_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d4hmge_:

Click to download the PDB-style file with coordinates for d4hmge_.
(The format of our PDB-style files is described here.)

Timeline for d4hmge_: