Lineage for d4hmga_ (4hmg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775945Domain d4hmga_: 4hmg A: [23831]
    Other proteins in same PDB: d4hmgb_, d4hmgd_, d4hmgf_
    complexed with nag, sia

Details for d4hmga_

PDB Entry: 4hmg (more details), 3 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing
PDB Compounds: (A:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d4hmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hmga_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d4hmga_:

Click to download the PDB-style file with coordinates for d4hmga_.
(The format of our PDB-style files is described here.)

Timeline for d4hmga_: