Lineage for d1ahsb_ (1ahs B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12156Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)
  4. 12157Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families) (S)
  5. 12158Family b.19.1.1: Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49819] (1 protein)
  6. 12159Protein Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)
  7. 12160Species African horse sickness virus [TaxId:40050] [49822] (1 PDB entry)
  8. 12162Domain d1ahsb_: 1ahs B: [23795]

Details for d1ahsb_

PDB Entry: 1ahs (more details), 2.3 Å

PDB Description: crystal structure of the top domain of african horse sickness virus vp7

SCOP Domain Sequences for d1ahsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahsb_ b.19.1.1 (B:) Virus coat protein vp7 (BTV-10 vp7), central (top) domain {African horse sickness virus}
tgpyagavevqqsgryyvpqgrtrggyinsniaevcmdagaagqvnallaprrgdavmiy
fvwrplrifcdpqgaslesapgtfvtvdgvnvaagdvvawntiapvnvgnpgarrsilqf
evlwyt

SCOP Domain Coordinates for d1ahsb_:

Click to download the PDB-style file with coordinates for d1ahsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ahsb_: