Lineage for d3w9tf1 (3w9t F:1-150)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543473Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species)
  7. 1543474Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries)
    Uniprot Q868M7 11-442
  8. 1543497Domain d3w9tf1: 3w9t F:1-150 [237910]
    Other proteins in same PDB: d3w9ta3, d3w9tb3, d3w9tc3, d3w9td3, d3w9te3, d3w9tf3, d3w9tg3
    automated match to d1vcla1
    complexed with ca, mg, w9t

Details for d3w9tf1

PDB Entry: 3w9t (more details), 2.9 Å

PDB Description: pore-forming cel-iii
PDB Compounds: (F:) hemolytic lectin CEL-III

SCOPe Domain Sequences for d3w9tf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w9tf1 b.42.2.1 (F:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]}
evlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearn
ycftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcl
diegsdgtgdigvydcqnlddqyfyvrsrg

SCOPe Domain Coordinates for d3w9tf1:

Click to download the PDB-style file with coordinates for d3w9tf1.
(The format of our PDB-style files is described here.)

Timeline for d3w9tf1: