Lineage for d1bvp62 (1bvp 6:121-254)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226172Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 226173Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 226174Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins)
    this domain is inserted into a multihelical domain
  6. 226175Protein Virus capsid protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)
  7. 226180Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)
  8. 226186Domain d1bvp62: 1bvp 6:121-254 [23780]
    Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61

Details for d1bvp62

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp62:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp62 b.19.1.1 (6:121-254) Virus capsid protein vp7 (BTV-10 vp7), central (top) domain {Bluetongue virus}
parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
amvqiqvvfyismd

SCOP Domain Coordinates for d1bvp62:

Click to download the PDB-style file with coordinates for d1bvp62.
(The format of our PDB-style files is described here.)

Timeline for d1bvp62: