SCOPe 2.08: Domain d1bvp62: 1bvp 6:121-254

Lineage for d1bvp62 (1bvp 6:121-254)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
   this domain is inserted into a multihelical domain

6. Protein BTV vp7, central (top) domain [49820] (1 species)

7. Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)

8. Domain d1bvp62: 1bvp 6:121-254 [23780]
   Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61

Details for d1bvp62

PDB Entry: 1bvp, 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

PDB Compounds: (6:) bluetongue virus coat protein vp7

SCOPe Domain Sequences for d1bvp62:

Sequence; same for both SEQRES and ATOM records:

>d1bvp62 b.19.1.1 (6:121-254) BTV vp7, central (top) domain {Bluetongue virus [TaxId: 40051]}
parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
amvqiqvvfyismd

Timeline for d1bvp62:

• d1bvp62 first appeared (with stable ids) in SCOP 1.55
  
• d1bvp62 appears in SCOPe 2.07