| Class b: All beta proteins [48724] (126 folds) |
| Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (3 families) ![]() forms homotrimers |
| Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins) this domain is inserted into a multihelical domain |
| Protein Virus capsid protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species) |
| Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries) |
| Domain d1bvp52: 1bvp 5:121-254 [23779] Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61 |
PDB Entry: 1bvp (more details), 2.6 Å
SCOP Domain Sequences for d1bvp52:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvp52 b.19.1.1 (5:121-254) Virus capsid protein vp7 (BTV-10 vp7), central (top) domain {Bluetongue virus}
parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
amvqiqvvfyismd
Timeline for d1bvp52: