SCOP 1.65: Domain d1bvp61: 1bvp 6:1-120,6:255-349

Lineage for d1bvp61 (1bvp 6:1-120,6:255-349)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
   multihelical; three-helical bundle in the core is surrounded by non-conserved helices

4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (2 families)
   this domain is interrupted by a jelly-roll beta-sanwich domain

5. Family a.115.1.1: Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48346] (1 protein)

6. Protein Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48347] (1 species)

7. Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)

8. Domain d1bvp61: 1bvp 6:1-120,6:255-349 [19084]
   Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp61

PDB Entry: 1bvp, 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp61:

Sequence; same for both SEQRES and ATOM records:

>d1bvp61 a.115.1.1 (6:1-120,6:255-349) Bluetongue virus capsid protein vp7 (BTV-10 vp7) {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

Timeline for d1bvp61:

• d1bvp61 first appeared (with stable ids) in SCOP 1.55
  
• d1bvp61 appears in SCOP 1.63
  
• d1bvp61 appears in SCOP 1.67
  
• d1bvp61 appears in the current release, SCOPe 2.08