Lineage for d1bvp31 (1bvp 3:1-120,3:255-349)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284835Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. 284836Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (2 families) (S)
    this domain is interrupted by a jelly-roll beta-sanwich domain
  5. 284837Family a.115.1.1: Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48346] (1 protein)
  6. 284838Protein Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48347] (1 species)
  7. 284839Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)
  8. 284842Domain d1bvp31: 1bvp 3:1-120,3:255-349 [19081]
    Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp31

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp31 a.115.1.1 (3:1-120,3:255-349) Bluetongue virus capsid protein vp7 (BTV-10 vp7) {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

SCOP Domain Coordinates for d1bvp31:

Click to download the PDB-style file with coordinates for d1bvp31.
(The format of our PDB-style files is described here.)

Timeline for d1bvp31: