Lineage for d3zq3a_ (3zq3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804836Species Norway rat (Rattus norvegicus) [TaxId:10116] [237753] (2 PDB entries)
  8. 2804837Domain d3zq3a_: 3zq3 A: [237754]
    automated match to d1df3a_

Details for d3zq3a_

PDB Entry: 3zq3 (more details), 2.8 Å

PDB Description: Crystal Structure of Rat Odorant Binding Protein 3 (OBP3)
PDB Compounds: (A:) obp3 protein

SCOPe Domain Sequences for d3zq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zq3a_ b.60.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeasfergnldvdklngdwfsivvasdkrekieengsmrvfvqhidvlenslgftfrike
ngvctefslvadktakdgeyfveydgentftilktdydnyvmfhlvnvnngetfqlmely
grtkdlssdikekfaklcvahgitrdniidltktdrclq

SCOPe Domain Coordinates for d3zq3a_:

Click to download the PDB-style file with coordinates for d3zq3a_.
(The format of our PDB-style files is described here.)

Timeline for d3zq3a_: