SCOP 1.57: Domain d1beha_: 1beh A:

Lineage for d1beha_ (1beh A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)

4. Superfamily b.17.1: PEBP-like [49777] (2 families)

5. Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (2 proteins)

6. Protein Phosphatidylethanolamine binding protein, PEBP [49779] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49780] (2 PDB entries)

8. Domain d1beha_: 1beh A: [23700]

Details for d1beha_

PDB Entry: 1beh, 1.75 Å

PDB Description: human phosphatidylethanolamine binding protein in complex with cacodylate

SCOP Domain Sequences for d1beha_:

Sequence; same for both SEQRES and ATOM records:

>d1beha_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Human (Homo sapiens)}
vdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsgk
lytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryvw
lvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpklye
qlsg

Timeline for d1beha_:

• d1beha_ first appeared (with stable ids) in SCOP 1.55
  
• d1beha_ appears in SCOP 1.59
  
• d1beha_ appears in the current release, SCOPe 2.08