Lineage for d1beha_ (1beh A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369531Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2369532Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2369533Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 protein domains)
  6. 2369541Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species)
  7. 2369546Species Human (Homo sapiens) [TaxId:9606] [49780] (3 PDB entries)
  8. 2369547Domain d1beha_: 1beh A: [23700]
    complexed with cac

Details for d1beha_

PDB Entry: 1beh (more details), 1.75 Å

PDB Description: human phosphatidylethanolamine binding protein in complex with cacodylate
PDB Compounds: (A:) phosphatidylethanolamine binding protein

SCOPe Domain Sequences for d1beha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beha_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Human (Homo sapiens) [TaxId: 9606]}
vdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsgk
lytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryvw
lvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpklye
qlsg

SCOPe Domain Coordinates for d1beha_:

Click to download the PDB-style file with coordinates for d1beha_.
(The format of our PDB-style files is described here.)

Timeline for d1beha_: