Lineage for d1behb_ (1beh B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57163Fold b.17: PEBP-like [49776] (1 superfamily)
  4. 57164Superfamily b.17.1: PEBP-like [49777] (2 families) (S)
  5. 57165Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (2 proteins)
  6. 57170Protein Phosphatidylethanolamine binding protein, PEBP [49779] (2 species)
  7. 57175Species Human (Homo sapiens) [TaxId:9606] [49780] (2 PDB entries)
  8. 57177Domain d1behb_: 1beh B: [23701]

Details for d1behb_

PDB Entry: 1beh (more details), 1.75 Å

PDB Description: human phosphatidylethanolamine binding protein in complex with cacodylate

SCOP Domain Sequences for d1behb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1behb_ b.17.1.1 (B:) Phosphatidylethanolamine binding protein, PEBP {Human (Homo sapiens)}
dlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsgkl
ytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryvwl
vyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpklyeq
lsg

SCOP Domain Coordinates for d1behb_:

Click to download the PDB-style file with coordinates for d1behb_.
(The format of our PDB-style files is described here.)

Timeline for d1behb_: