SCOPe 2.08: Domain d1behb_: 1beh B:

Lineage for d1behb_ (1beh B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)

6. Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49780] (3 PDB entries)

8. Domain d1behb_: 1beh B: [23701]
   complexed with cac

Details for d1behb_

PDB Entry: 1beh, 1.75 Å

PDB Description: human phosphatidylethanolamine binding protein in complex with cacodylate

PDB Compounds: (B:) phosphatidylethanolamine binding protein

SCOPe Domain Sequences for d1behb_:

Sequence; same for both SEQRES and ATOM records:

>d1behb_ b.17.1.1 (B:) Phosphatidylethanolamine binding protein, PEBP {Human (Homo sapiens) [TaxId: 9606]}
dlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsgkl
ytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryvwl
vyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpklyeq
lsg

Timeline for d1behb_:

• d1behb_ first appeared (with stable ids) in SCOP 1.55
  
• d1behb_ appears in SCOPe 2.07