Lineage for d1beha_ (1beh A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.17: Phosphatidylethanolamine binding protein [49776] (1 superfamily) Superfamily b.17.1: Phosphatidylethanolamine binding protein [49777] (1 family) 
Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (2 proteins) Protein Phosphatidylethanolamine binding protein, PEBP [49779] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [49780] (2 PDB entries) 
Domain d1beha_: 1beh A: [23700]
Details for d1beha_
PDB Entry: 1beh (more details), 1.75 Å
PDB Description: human phosphatidylethanolamine binding protein in complex with cacodylate
SCOP Domain Sequences for d1beha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1beha_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Human (Homo sapiens)}
vdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsgk
lytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryvw
lvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpklye
qlsg
SCOP Domain Coordinates for d1beha_:
Click to download the PDB-style file with coordinates for d1beha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1beha_:
- d1beha_ appears in SCOP 1.57
- d1beha_ appears in the current release, SCOPe 2.08
View in 3D
