SCOPe 2.08: Domain d4no1q1: 4no1 Q:1-234

Lineage for d4no1q1 (4no1 Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d4no1q1: 4no1 Q:1-234 [236926]
   Other proteins in same PDB: d4no1a_, d4no1c2, d4no1e_, d4no1f_, d4no1i_, d4no1j_, d4no1k_, d4no1l_, d4no1n_, d4no1o_, d4no1q2, d4no1s_, d4no1t_, d4no1w_, d4no1x_, d4no1y_, d4no1z_
   automated match to d2zcyc_
   complexed with cix, mg

Details for d4no1q1

PDB Entry: 4no1, 2.5 Å

PDB Description: ycp in complex with z-leu-leu-leu-b(oh)2

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4no1q1:

Sequence; same for both SEQRES and ATOM records:

>d4no1q1 d.153.1.4 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4no1q1:

• d4no1q1 first appeared in SCOPe 2.03, called d4no1q_
  
• d4no1q1 was called d4no1q_ in SCOPe 2.07